Lineage for d3f1nb_ (3f1n B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. Protein automated matches [190492] (24 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187434] (30 PDB entries)
  8. Domain d3f1nb_: 3f1n B: [175410]
    Other proteins in same PDB: d3f1na1, d3f1na2
    automated match to d1p97a_
    complexed with edo

Details for d3f1nb_

PDB Entry: 3f1n (more details), 1.48 Å

PDB Description: crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with internally bound ethylene glycol.
PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d3f1nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f1nb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv
klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknss

SCOPe Domain Coordinates for d3f1nb_ are not available.

Timeline for d3f1nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3f1na1, d3f1na2