Lineage for d3f0oa1 (3f0o A:1-80)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260067Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein)
  6. 1260068Protein Alkylmercury lyase MerB [158324] (1 species)
  7. 1260069Species Escherichia coli [TaxId:562] [158325] (7 PDB entries)
    Uniprot P77072 21-80
  8. 1260072Domain d3f0oa1: 3f0o A:1-80 [209759]
    Other proteins in same PDB: d3f0oa2, d3f0ob2
    automated match to d1s6la1
    complexed with br

Details for d3f0oa1

PDB Entry: 3f0o (more details), 1.76 Å

PDB Description: Crystal structure of MerB, the Organomercurial Lyase involved in a bacterial mercury resistance system
PDB Compounds: (A:) Alkylmercury lyase

SCOPe Domain Sequences for d3f0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0oa1 a.4.5.79 (A:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre

SCOPe Domain Coordinates for d3f0oa1:

Click to download the PDB-style file with coordinates for d3f0oa1.
(The format of our PDB-style files is described here.)

Timeline for d3f0oa1:

1260072
d3f0oa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3f0oa2