Lineage for d3exva_ (3exv A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386582Species Human adenovirus b [TaxId:108098] [226821] (1 PDB entry)
  8. 2386583Domain d3exva_: 3exv A: [209727]
    automated match to d3f0ya_

Details for d3exva_

PDB Entry: 3exv (more details), 1.45 Å

PDB Description: crystal structure of the human adenovirus type 11 fiber knob
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d3exva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exva_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus b [TaxId: 108098]}
dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
ttlvtspftfyyiredd

SCOPe Domain Coordinates for d3exva_:

Click to download the PDB-style file with coordinates for d3exva_.
(The format of our PDB-style files is described here.)

Timeline for d3exva_: