Lineage for d3eula_ (3eul A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. Protein automated matches [190131] (85 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:1773] [225553] (2 PDB entries)
  8. Domain d3eula_: 3eul A: [209669]
    automated match to d3h1ga_
    complexed with cl

Details for d3eula_

PDB Entry: 3eul (more details), 1.9 Å

PDB Description: structure of the signal receiver domain of the putative response regulator narl from mycobacterium tuberculosis
PDB Compounds: (A:) POSSIBLE NITRATE/NITRITE RESPONSE TRANSCRIPTIONAL REGULATORY PROTEIN NARL (DNA-binding response regulator, LuxR family)

SCOPe Domain Sequences for d3eula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eula_ c.23.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ekvrvvvgddhplfregvvralslsgsvnvvgeaddgaaalelikahlpdvalldyrmpg
mdgaqvaaavrsyelptrvllisahdepaivyqalqqgaagfllkdstrteivkavldca
kgr

SCOPe Domain Coordinates for d3eula_ are not available.

Timeline for d3eula_:

Domains from other chains:
(mouse over for more information)
d3eulb_, d3eulc_, d3euld_