Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
Protein automated matches [232090] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries) |
Domain d3eub32: 3eub 3:415-528 [232092] Other proteins in same PDB: d3eub21, d3eub22, d3eub31, d3eub41, d3eub42, d3euba1, d3euba2, d3eubb1, d3eubc1, d3eubc2, d3eubj1, d3eubj2, d3eubk1, d3eubl1, d3eubl2, d3eubs1, d3eubs2, d3eubt1, d3eubu1, d3eubu2 automated match to d1v97a4 complexed with fad, fes, mom, mte, xan |
PDB Entry: 3eub (more details), 2.6 Å
SCOPe Domain Sequences for d3eub32:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eub32 d.87.2.0 (3:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3eub32: