Lineage for d3etla1 (3etl A:2-63)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. Family a.60.4.0: automated matches [227240] (1 protein)
    not a true family
  6. Protein automated matches [227003] (2 species)
    not a true protein
  7. Species Methanococcus maripaludis [TaxId:39152] [225662] (3 PDB entries)
  8. Domain d3etla1: 3etl A:2-63 [209663]
    Other proteins in same PDB: d3etla2
    automated match to d1pzna1
    protein/DNA complex; complexed with anp, mg

Details for d3etla1

PDB Entry: 3etl (more details), 2.4 Å

PDB Description: RadA recombinase from Methanococcus maripaludis in complex with AMPPNP
PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d3etla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etla1 a.60.4.0 (A:2-63) automated matches {Methanococcus maripaludis [TaxId: 39152]}
advltelpgvgpstadklieggyldfmkiatatigeltdiegisekaaakmimaardlcd
lg

SCOPe Domain Coordinates for d3etla1 are not available.

Timeline for d3etla1:

Domains from same chain:
(mouse over for more information)
d3etla2