Lineage for d3etfc_ (3etf C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2909027Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2909028Protein automated matches [190683] (61 species)
    not a true protein
  7. 2909846Species Salmonella typhimurium [TaxId:602] [311283] (2 PDB entries)
  8. 2909853Domain d3etfc_: 3etf C: [305301]
    automated match to d4i26c_

Details for d3etfc_

PDB Entry: 3etf (more details), 1.85 Å

PDB Description: crystal structure of a putative succinate-semialdehyde dehydrogenase from salmonella typhimurium lt2
PDB Compounds: (C:) Putative succinate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d3etfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3etfc_ c.82.1.0 (C:) automated matches {Salmonella typhimurium [TaxId: 602]}
qalsvnpatgqtlaampwanaqeiehalslaasgfkkwkmtsvaqraqtlrdigqalrah
aeemaqcitremgkpikqaraevtksaalcdwyaehgpamlnpeptlvenqqavieyrpl
gvilaimpwnfplwqvlrgavpillagnsyllkhapnvtgcaqmiarilaeagtpagvyg
wvnannegvsqmindpriaavtvtgsvragaaigaqagaalkkcvlelggsdpfivlnda
dlelavkaavagryqntgqvcaaakrfiveegiaqaftdrfvaaaaalkmgdplveendl
gpmarfdlrdelhqqvqasvaegarlllggekiagegnyyaatvladvtpdmtafrqelf
gpvaaitvakdaahalalandsefglsatiftaddtlaaemaarlecggvfingysasda
rvafggvkksgfgrelshfglhefcnvqtvwknrv

SCOPe Domain Coordinates for d3etfc_:

Click to download the PDB-style file with coordinates for d3etfc_.
(The format of our PDB-style files is described here.)

Timeline for d3etfc_: