Lineage for d3eqva1 (3eqv A:53-237)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. Family d.175.1.0: automated matches [227232] (1 protein)
    not a true family
  6. Protein automated matches [226981] (13 species)
    not a true protein
  7. Species Neisseria gonorrhoeae [TaxId:485] [225540] (3 PDB entries)
  8. Domain d3eqva1: 3eqv A:53-237 [232067]
    Other proteins in same PDB: d3eqva2, d3eqvb2
    automated match to d3equa1
    complexed with gol, so4; mutant

Details for d3eqva1

PDB Entry: 3eqv (more details), 2.4 Å

PDB Description: crystal structure of penicillin-binding protein 2 from neisseria gonorrhoeae containing four mutations associated with penicillin resistance
PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d3eqva1:

Sequence, based on SEQRES records: (download)

>d3eqva1 d.175.1.0 (A:53-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tynflkeqgdnrivrtqalpatrgtvsdrngavlalsapteslfavpkdmkempsaaqle
rlselvdvpvdvlrnkleqkgksfiwikrqldpkvaeevkalglenfvfekelkrhypmg
nlfahvigftdidgkgqeglelsledslygedgaevvlrdrqgnivdsldsprnkapqng
kdiil

Sequence, based on observed residues (ATOM records): (download)

>d3eqva1 d.175.1.0 (A:53-237) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
tynflkeqgdnrivrtqalpatrgtvsdrngavlalsapteelkrhypmgnlfahvigft
didgkgqeglelsledslygedgaevvlrdrqgnivdsldsprnkapqngkdiil

SCOPe Domain Coordinates for d3eqva1 are not available.

Timeline for d3eqva1:

Domains from same chain:
(mouse over for more information)
d3eqva2
Domains from other chains:
(mouse over for more information)
d3eqvb1, d3eqvb2