Lineage for d3eotl1 (3eot L:1-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766717Domain d3eotl1: 3eot L:1-111 [209588]
    Other proteins in same PDB: d3eotl2
    automated match to d2fbjl1

Details for d3eotl1

PDB Entry: 3eot (more details), 1.9 Å

PDB Description: crystal structure of lac031, an engineered anti-vla1 fab
PDB Compounds: (L:) Fab fragment, light chain

SCOPe Domain Sequences for d3eotl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eotl1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qiqltqspsslsasvgdrvtitcsasssvnssalfwyqqkpgkapkpwiyltsnlasgvp
srfsgsgsgtdytltisslqpedfatyycqqisgnpwtfgqgtkveikrad

SCOPe Domain Coordinates for d3eotl1:

Click to download the PDB-style file with coordinates for d3eotl1.
(The format of our PDB-style files is described here.)

Timeline for d3eotl1: