Lineage for d3enkb_ (3enk B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (309 species)
not a true protein
Species Burkholderia pseudomallei [TaxId:320372] [188646] (7 PDB entries) 
Domain d3enkb_: 3enk B: [175102]
automated match to d1ek5a_
complexed with nad, upg
Details for d3enkb_
PDB Entry: 3enk (more details), 1.9 Å
PDB Description: 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
PDB Compounds: (B:) UDP-glucose 4-epimeraseSCOPe Domain Sequences for d3enkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3enkb_ c.2.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mstkgtilvtggagyigshtavellahgydvviadnlvnskreaiariekitgktpafhe
tdvsderalarifdahpitaaihfaalkavgesvakpieyyrnnldsllsllrvmrerav
krivfsssatvygvperspidetfplsatnpygqtklmaeqilrdveaadpswrvatlry
fnpvgahesgligedpagipnnlmpyvaqvavgkleklrvfgsdyptpdgtgvrdyihvv
dlarghiaaldalerrdasltvnlgtgrgysvlevvrafekasgravpyelvarrpgdva
ecyanpaaaaetigwkaerdlermcadhwrwqennprgf
SCOPe Domain Coordinates for d3enkb_:
Click to download the PDB-style file with coordinates for d3enkb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3enkb_:
- d3enkb_ first appeared in SCOPe 2.01
- d3enkb_ appears in SCOPe 2.06
- d3enkb_ appears in the current release, SCOPe 2.08
View in 3D
