Lineage for d3enkb_ (3enk B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350255Species Burkholderia pseudomallei [TaxId:320372] [188646] (4 PDB entries)
  8. 1350257Domain d3enkb_: 3enk B: [175102]
    automated match to d1ek5a_
    complexed with nad, upg

Details for d3enkb_

PDB Entry: 3enk (more details), 1.9 Å

PDB Description: 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d3enkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3enkb_ c.2.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mstkgtilvtggagyigshtavellahgydvviadnlvnskreaiariekitgktpafhe
tdvsderalarifdahpitaaihfaalkavgesvakpieyyrnnldsllsllrvmrerav
krivfsssatvygvperspidetfplsatnpygqtklmaeqilrdveaadpswrvatlry
fnpvgahesgligedpagipnnlmpyvaqvavgkleklrvfgsdyptpdgtgvrdyihvv
dlarghiaaldalerrdasltvnlgtgrgysvlevvrafekasgravpyelvarrpgdva
ecyanpaaaaetigwkaerdlermcadhwrwqennprgf

SCOPe Domain Coordinates for d3enkb_:

Click to download the PDB-style file with coordinates for d3enkb_.
(The format of our PDB-style files is described here.)

Timeline for d3enkb_: