Lineage for d3en6b_ (3en6 B:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPKFamily d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
members organized in the groups and subfamiles specified by the comments
Protein c-src tyrosine kinase [56155] (3 species)
PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
Species Chicken (Gallus gallus) [TaxId:9031] [56157] (54 PDB entries) 
Domain d3en6b_: 3en6 B: [209558]
automated match to d2gqgb_
complexed with ks5
Details for d3en6b_
PDB Entry: 3en6 (more details), 2.39 Å
PDB Description: targeted polypharmacology: crystal structure of the c-src kinase domain in complex with pp102, a multitargeted kinase inhibitor
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase SrcSCOPe Domain Sequences for d3en6b_:
Sequence, based on SEQRES records: (download)
>d3en6b_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkk
lrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmay
vermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaaly
grftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmc
qcwrkdpeerptfeylqafledyftstepqyqpgenl
Sequence, based on observed residues (ATOM records): (download)
>d3en6b_ d.144.1.7 (B:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
kdaweipreslrlevklgqfgevwmgtwngttrvaiktlaqvmkklrheklvqlyavvsi
yivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraanilv
genlvckvadfikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldq
vergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
SCOPe Domain Coordinates for d3en6b_:
Click to download the PDB-style file with coordinates for d3en6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3en6b_:
- d3en6b_ first appeared in SCOPe 2.03
- d3en6b_ appears in SCOPe 2.06
- d3en6b_ appears in the current release, SCOPe 2.08
View in 3D
