Lineage for d3elgb_ (3elg B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920207Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 1920247Superfamily d.98.2: BT0923-like [160574] (2 families) (S)
    Duplication: tandem repeat of two similar structural subdomains, which associate like the BLIP repeats but differ from them by transposition of the helices
  5. 1920248Family d.98.2.1: BT0923-like [160575] (3 proteins)
    after putative calcium-regulated periplasmic protein BT0923 (PDB ID 3DUE; new)
  6. 1920249Protein Putative periplasmic protein BVU2443 [160576] (1 species)
  7. 1920250Species Bacteroides vulgatus [TaxId:821] [160577] (1 PDB entry)
    Uniprot A6L337 20-146
  8. 1920252Domain d3elgb_: 3elg B: [158183]
    automated match to d3elga1
    complexed with cit

Details for d3elgb_

PDB Entry: 3elg (more details), 1.64 Å

PDB Description: crystal structure of a putative periplasmic protein of unknown function (bvu_2443) from bacteroides vulgatus atcc 8482 at 1.64 a resolution
PDB Compounds: (B:) uncharacterized periplasmic protein

SCOPe Domain Sequences for d3elgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3elgb_ d.98.2.1 (B:) Putative periplasmic protein BVU2443 {Bacteroides vulgatus [TaxId: 821]}
gdvvtrdvnklpvaaremigkhfsqtkvayikiekdlfqttsydvkladgielefnskge
wleidcknksvpstfipqaiskymkanynghktvkiernrkgyeltlenglevdfdqfgg
flklsd

SCOPe Domain Coordinates for d3elgb_:

Click to download the PDB-style file with coordinates for d3elgb_.
(The format of our PDB-style files is described here.)

Timeline for d3elgb_: