Lineage for d3ek2a_ (3ek2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843048Species Burkholderia pseudomallei [TaxId:320372] [188614] (3 PDB entries)
  8. 2843053Domain d3ek2a_: 3ek2 A: [174992]
    automated match to d1c14a_
    complexed with cl

Details for d3ek2a_

PDB Entry: 3ek2 (more details), 1.9 Å

PDB Description: crystal structure of eonyl-(acyl carrier protein) reductase from burkholderia pseudomallei 1719b
PDB Compounds: (A:) Enoyl-(Acyl-carrier-protein) reductase (NADH)

SCOPe Domain Sequences for d3ek2a_:

Sequence, based on SEQRES records: (download)

>d3ek2a_ c.2.1.2 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
taevmhvdsgfnavvggm

Sequence, based on observed residues (ATOM records): (download)

>d3ek2a_ c.2.1.2 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
gvrvnaisagpisgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvtaevm
hvdsgfnavvggm

SCOPe Domain Coordinates for d3ek2a_:

Click to download the PDB-style file with coordinates for d3ek2a_.
(The format of our PDB-style files is described here.)

Timeline for d3ek2a_: