SCOPe 2.07: Domain d3ejxa1: 3ejx A:25-158

Lineage for d3ejxa1 (3ejx A:25-158)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
duplication: consists of two similar domain swapped with C-terminal strands
Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
automatically mapped to Pfam PF01678
Protein Diaminopimelate epimerase [54508] (3 species)
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267831] (2 PDB entries)
Domain d3ejxa1: 3ejx A:25-158 [264749]
Other proteins in same PDB: d3ejxb3
automated match to d4ijza1
complexed with zdp

Details for d3ejxa1

PDB Entry: 3ejx (more details), 1.95 Å

PDB Description: Crystal structure of diaminopimelate epimerase from Arabidopsis thaliana in complex with LL-AziDAP

PDB Compounds: (A:) Diaminopimelate epimerase, chloroplastic

SCOPe Domain Sequences for d3ejxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ejxa1 d.21.1.1 (A:25-158) Diaminopimelate epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvlhfvkyhglgndfilvdnrdssepkitqeqaaklcdrnfgvgadgvifampgvngtdy
amrifnsdgsepemcgngvrcfarfiaelenlqgkhsftihtgaglivpeiqddgqvkvd
mgtpilkaqdvptk

SCOPe Domain Coordinates for d3ejxa1:

Click to download the PDB-style file with coordinates for d3ejxa1.
(The format of our PDB-style files is described here.)

Timeline for d3ejxa1: