Lineage for d3eina2 (3ein A:86-208)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domainFamily a.45.1.0: automated matches [227130] (1 protein)
not a true familyProtein automated matches [226831] (61 species)
not a true protein
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (8 PDB entries) 
Domain d3eina2: 3ein A:86-208 [209505]
Other proteins in same PDB: d3eina1
automated match to d1jlva1
complexed with gsh
Details for d3eina2
PDB Entry: 3ein (more details), 1.13 Å
PDB Description: delta class gst
PDB Compounds: (A:) Glutathione S-transferase 1-1SCOPe Domain Sequences for d3eina2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eina2 a.45.1.0 (A:86-208) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpeafkkieaafeflntflegq
dyaagdsltvadialvatvstfevakfeiskyanvnrwyenakkvtpgweenwagclefk
kyf
SCOPe Domain Coordinates for d3eina2:
Click to download the PDB-style file with coordinates for d3eina2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3eina2:
- d3eina2 first appeared in SCOPe 2.03
- d3eina2 appears in SCOPe 2.05
- d3eina2 appears in SCOPe 2.07
- d3eina2 appears in the current release, SCOPe 2.08
View in 3D
