Lineage for d3egpa_ (3egp A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376067Species Dengue virus 1 [TaxId:11053] [311284] (2 PDB entries)
  8. 2376069Domain d3egpa_: 3egp A: [305263]
    automated match to d2h0pa_

Details for d3egpa_

PDB Entry: 3egp (more details), 2.4 Å

PDB Description: Crystal structure analysis of dengue-1 envelope protein domain III
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d3egpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3egpa_ b.1.18.0 (A:) automated matches {Dengue virus 1 [TaxId: 11053]}
msyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanp
ivtdkekpvnieaeppfgesyivvgagekalklswfkkgssi

SCOPe Domain Coordinates for d3egpa_:

Click to download the PDB-style file with coordinates for d3egpa_.
(The format of our PDB-style files is described here.)

Timeline for d3egpa_: