Lineage for d3eg7a_ (3eg7 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921812Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 1921813Protein automated matches [190038] (32 species)
    not a true protein
  7. 1922024Species Vibrio cholerae [TaxId:666] [188612] (12 PDB entries)
  8. 1922038Domain d3eg7a_: 3eg7 A: [174920]
    automated match to d1nsla_
    complexed with ipa, mg

Details for d3eg7a_

PDB Entry: 3eg7 (more details), 2.38 Å

PDB Description: spermidine n1-acetyltransferase from vibrio cholerae
PDB Compounds: (A:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d3eg7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eg7a_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrs

SCOPe Domain Coordinates for d3eg7a_:

Click to download the PDB-style file with coordinates for d3eg7a_.
(The format of our PDB-style files is described here.)

Timeline for d3eg7a_: