Class a: All alpha proteins [46456] (290 folds) |
Fold a.184: TorD-like [89154] (1 superfamily) multihelical; bundle |
Superfamily a.184.1: TorD-like [89155] (1 family) |
Family a.184.1.1: TorD-like [89156] (5 proteins) Pfam PF06192 |
Protein automated matches [191026] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries) |
Domain d3efpa_: 3efp A: [174916] Other proteins in same PDB: d3efpb2 automated match to d1s9ua_ complexed with cl, gol, na, trs |
PDB Entry: 3efp (more details), 2.01 Å
SCOPe Domain Sequences for d3efpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3efpa_ a.184.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mthfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtaf qtqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemk qnepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralge larltlaqwqsqllipvavkplfr
Timeline for d3efpa_: