Lineage for d3efka_ (3efk A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
PTK group; HGFR subfamily; membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [103301] (38 PDB entries) 
Domain d3efka_: 3efk A: [174912]
automated match to d1r0pa_
complexed with mt4
Details for d3efka_
PDB Entry: 3efk (more details), 2.2 Å
PDB Description: structure of c-met with pyrimidone inhibitor 50
PDB Compounds: (A:) Hepatocyte growth factor receptorSCOPe Domain Sequences for d3efka_:
Sequence, based on SEQRES records: (download)
>d3efka_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksln
ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
hnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydke
yysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfdit
vyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyvh
Sequence, based on observed residues (ATOM records): (download)
>d3efka_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavksln
ritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnet
hnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfpvkwmalesl
qtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyev
mlkcwhpkaemrpsfselvsrisaifstfigehyvh
SCOPe Domain Coordinates for d3efka_:
Click to download the PDB-style file with coordinates for d3efka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3efka_:
- d3efka_ first appeared in SCOPe 2.01
- d3efka_ appears in SCOPe 2.04
- d3efka_ appears in SCOPe 2.06
- d3efka_ appears in the current release, SCOPe 2.08
View in 3D
