Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.21: Ava4193-like [160012] (1 protein) PfamB PB183524 |
Protein Uncharacterized protein Ava4193 [160013] (1 species) |
Species Anabaena variabilis [TaxId:1172] [160014] (1 PDB entry) Uniprot Q3M5E4 2-129 |
Domain d3ecfa1: 3ecf A:2-129 [158094] complexed with so4, unl |
PDB Entry: 3ecf (more details), 1.9 Å
SCOPe Domain Sequences for d3ecfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ecfa1 d.17.4.21 (A:2-129) Uncharacterized protein Ava4193 {Anabaena variabilis [TaxId: 1172]} atekyheilkkyflsfetgdfsqvqfscnleflspisgntlkgteevipflkgvttrvae vnimsttveyprasgvwqmrttkgtlytlhnffrldeegivyvwpmfdpkavmenpdali qwltgkdy
Timeline for d3ecfa1: