Class g: Small proteins [56992] (100 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
Protein Erabutoxin B (also neurotoxin B) [57304] (1 species) |
Species Sea snake (Laticauda semifasciata) [TaxId:8631] [57305] (7 PDB entries) |
Domain d3ebxa_: 3ebx A: [44389] complexed with so4 |
PDB Entry: 3ebx (more details), 1.4 Å
SCOPe Domain Sequences for d3ebxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ebxa_ g.7.1.1 (A:) Erabutoxin B (also neurotoxin B) {Sea snake (Laticauda semifasciata) [TaxId: 8631]} ricfnhqssqpqttktcspgesscyhkqwsdfrgtiiergcgcptvkpgiklsccesevc nn
Timeline for d3ebxa_: