Lineage for d3eb3a_ (3eb3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2438162Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)
  7. 2438163Species Norway rat (Rattus norvegicus) [TaxId:10116] [51435] (12 PDB entries)
  8. 2438165Domain d3eb3a_: 3eb3 A: [174813]
    automated match to d1exba_
    complexed with ndp, pdn

Details for d3eb3a_

PDB Entry: 3eb3 (more details), 2 Å

PDB Description: voltage-dependent k+ channel beta subunit (w121a) in complex with cortisone
PDB Compounds: (A:) Voltage-gated potassium channel subunit beta-2

SCOPe Domain Sequences for d3eb3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eb3a_ c.1.7.1 (A:) Voltage-dependent K+ channel beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagk
aevvlgniikkkgwrrsslvittkifaggkaeterglsrkhiieglkaslerlqleyvdv
vfanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceq
aeyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlk
dkilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeni
gaiqvlpklsssivheidsilgnkpy

SCOPe Domain Coordinates for d3eb3a_:

Click to download the PDB-style file with coordinates for d3eb3a_.
(The format of our PDB-style files is described here.)

Timeline for d3eb3a_: