![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (94 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [188556] (2 PDB entries) |
![]() | Domain d3eb2a_: 3eb2 A: [174809] Other proteins in same PDB: d3eb2b2, d3eb2b3, d3eb2d2 automated match to d1xkya1 complexed with pge |
PDB Entry: 3eb2 (more details), 2.04 Å
SCOPe Domain Sequences for d3eb2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eb2a_ c.1.10.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} dfhgvfpylvspvdaegrvradvmgrlcddliqagvhgltplgstgefaylgtaqreavv ratieaaqrrvpvvagvastsvadavaqaklyeklgadgilaileayfplkdaqiesyfr aiadaveipvviytnpqfqrsdltldviarlaehpriryikdastntgrllsiinrcgda lqvfsasahipaavmliggvgwmagpaciaprqsvalyelckaqrwdealmlqrklwrvn eafakfnlaacikaglalqgydvgdpippqaaltaeerkavekvlaei
Timeline for d3eb2a_: