Lineage for d3eaua_ (3eau A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817859Protein Voltage-dependent K+ channel beta subunit [51434] (1 species)
  7. 1817860Species Norway rat (Rattus norvegicus) [TaxId:10116] [51435] (11 PDB entries)
  8. 1817861Domain d3eaua_: 3eau A: [158080]
    automated match to d1exba_
    complexed with ndp, pdn

Details for d3eaua_

PDB Entry: 3eau (more details), 1.82 Å

PDB Description: Voltage-dependent K+ channel beta subunit in complex with cortisone
PDB Compounds: (A:) Voltage-gated potassium channel subunit beta-2

SCOPe Domain Sequences for d3eaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eaua_ c.1.7.1 (A:) Voltage-dependent K+ channel beta subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagk
aevvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdv
vfanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceq
aeyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlk
dkilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmeni
gaiqvlpklsssivheidsilgnkpys

SCOPe Domain Coordinates for d3eaua_:

Click to download the PDB-style file with coordinates for d3eaua_.
(The format of our PDB-style files is described here.)

Timeline for d3eaua_: