Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Shigella flexneri [TaxId:198214] [225525] (1 PDB entry) |
Domain d3e9qa1: 3e9q A:1-252 [209441] Other proteins in same PDB: d3e9qa2, d3e9qb2 automated match to d3iahb_ complexed with edo, gol, so4, zn |
PDB Entry: 3e9q (more details), 1.7 Å
SCOPe Domain Sequences for d3e9qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e9qa1 c.2.1.0 (A:1-252) automated matches {Shigella flexneri [TaxId: 198214]} mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet grqpqwfildlltctsencqqlaqrivvnyprldgvlhnagllgdvcpmseqnpqvwqdv mqinvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf daqpgrkpgisq
Timeline for d3e9qa1: