Lineage for d3e66a1 (3e66 A:1833-2087)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (16 families) 
consists of one domain of this foldFamily c.55.3.14: Prp8 beta-finger domain-like [159638] (1 protein)
automatically mapped to Pfam PF12134Protein Pre-mRNA splicing factor 8, Prp8 / Spp42 [159639] (4 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [159641] (5 PDB entries)
Uniprot P33334 1833-2087! Uniprot P33334 1835-2087
Domain d3e66a1: 3e66 A:1833-2087 [158032]
Details for d3e66a1
PDB Entry: 3e66 (more details), 2.05 Å
PDB Description: Crystal structure of the beta-finger domain of yeast Prp8
PDB Compounds: (A:) prp8SCOPe Domain Sequences for d3e66a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e66a1 c.55.3.14 (A:1833-2087) Pre-mRNA splicing factor 8, Prp8 / Spp42 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pflnssnyaelfnndiklfvddtnvyrvtvhktfegnvatkaingciftlnpktghlflk
iihtsvwagqkrlsqlakwktaeevsalvrslpkeeqpkqiivtrkamldplevhmldfp
niairptelrlpfsaamsidklsdvvmkatepqmvlfniyddwldrissytafsrltlll
ralktneesakmillsdptitiksyhlwpsftdeqwitiesqmrdlilteygrkynvnis
altqteikdiilgqn
SCOPe Domain Coordinates for d3e66a1:
Click to download the PDB-style file with coordinates for d3e66a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3e66a1:
- d3e66a1 first appeared in SCOP 1.75
- d3e66a1 appears in SCOPe 2.06
- d3e66a1 appears in the current release, SCOPe 2.08
View in 3D
