Lineage for d3e4fa_ (3e4f A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the restSuperfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) 
Family c.140.1.0: automated matches [191555] (1 protein)
not a true familyProtein automated matches [190957] (7 species)
not a true protein
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries) 
Domain d3e4fa_: 3e4f A: [174653]
automated match to d2nygd1
complexed with cit
Details for d3e4fa_
PDB Entry: 3e4f (more details), 2 Å
PDB Description: crystal structure of ba2930- a putative aminoglycoside n3- acetyltransferase from bacillus anthracis
PDB Compounds: (A:) Aminoglycoside N3-acetyltransferaseSCOPe Domain Sequences for d3e4fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e4fa_ c.140.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
divastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevitee
gtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrtypn
vvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsntsv
hlsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgkign
akcrlmkqrdivdfgtewfrkk
SCOPe Domain Coordinates for d3e4fa_:
Click to download the PDB-style file with coordinates for d3e4fa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3e4fa_:
- d3e4fa_ first appeared in SCOPe 2.01
- d3e4fa_ appears in SCOPe 2.07
View in 3D
