Lineage for d3e4fa_ (3e4f A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923433Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 2923434Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 2923450Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 2923451Protein automated matches [190957] (7 species)
    not a true protein
  7. 2923452Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188566] (4 PDB entries)
  8. 2923453Domain d3e4fa_: 3e4f A: [174653]
    automated match to d2nygd1
    complexed with cit

Details for d3e4fa_

PDB Entry: 3e4f (more details), 2 Å

PDB Description: crystal structure of ba2930- a putative aminoglycoside n3- acetyltransferase from bacillus anthracis
PDB Compounds: (A:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3e4fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e4fa_ c.140.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
divastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevitee
gtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrtypn
vvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsntsv
hlsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgkign
akcrlmkqrdivdfgtewfrkk

SCOPe Domain Coordinates for d3e4fa_:

Click to download the PDB-style file with coordinates for d3e4fa_.
(The format of our PDB-style files is described here.)

Timeline for d3e4fa_: