Lineage for d3e46a1 (3e46 A:157-200)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985369Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1985451Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 1985452Species Human (Homo sapiens) [TaxId:9606] [140328] (7 PDB entries)
    Uniprot P61086 157-198
  8. 1985454Domain d3e46a1: 3e46 A:157-200 [157994]
    Other proteins in same PDB: d3e46a2, d3e46a3
    complexed with ca; mutant

Details for d3e46a1

PDB Entry: 3e46 (more details), 1.86 Å

PDB Description: crystal structure of ubiquitin-conjugating enzyme e2-25kda (huntington interacting protein 2) m172a mutant
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDa

SCOPe Domain Sequences for d3e46a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e46a1 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcaagfdrnavivalsskswdvetatelllsn

SCOPe Domain Coordinates for d3e46a1:

Click to download the PDB-style file with coordinates for d3e46a1.
(The format of our PDB-style files is described here.)

Timeline for d3e46a1: