Lineage for d3e46a1 (3e46 A:157-200)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
3 helices; bundle, right-handed twistSuperfamily a.5.2: UBA-like [46934] (5 families) 
Family a.5.2.1: UBA domain [46935] (25 proteins) 
Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species) Species Human (Homo sapiens) [TaxId:9606] [140328] (6 PDB entries)
Uniprot P61086 157-198
Domain d3e46a1: 3e46 A:157-200 [157994]
Other proteins in same PDB: d3e46a2
complexed with ca; mutant
Details for d3e46a1
PDB Entry: 3e46 (more details), 1.86 Å
PDB Description: crystal structure of ubiquitin-conjugating enzyme e2-25kda (huntington interacting protein 2) m172a mutant
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2-25 kDaSCOPe Domain Sequences for d3e46a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e46a1 a.5.2.1 (A:157-200) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcaagfdrnavivalsskswdvetatelllsn
SCOPe Domain Coordinates for d3e46a1:
Click to download the PDB-style file with coordinates for d3e46a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3e46a1:
- d3e46a1 first appeared in SCOP 1.75
- d3e46a1 appears in SCOPe 2.03
- d3e46a1 appears in SCOPe 2.05
- d3e46a1 appears in the current release, SCOPe 2.08
View in 3D
