Lineage for d3e3kb_ (3e3k B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914454Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2914459Species Escherichia coli [TaxId:562] [102695] (28 PDB entries)
  8. 2914516Domain d3e3kb_: 3e3k B: [157992]
    automated match to d1zlqa1
    complexed with act, cl, gol, hct, so4

    has additional subdomain(s) that are not in the common domain

Details for d3e3kb_

PDB Entry: 3e3k (more details), 2.8 Å

PDB Description: Structural characterization of a putative endogenous metal chelator in the periplasmic nickel transporter NikA (butane-1,2,4-tricarboxylate without nickel form)
PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3e3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e3kb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikpvkp

SCOPe Domain Coordinates for d3e3kb_:

Click to download the PDB-style file with coordinates for d3e3kb_.
(The format of our PDB-style files is described here.)

Timeline for d3e3kb_: