Lineage for d3e11a1 (3e11 A:1-113)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206169Family d.92.1.17: TTHA0227-like [160555] (2 proteins)
    Pfam PFPF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
    Pfam PF06262; DUF1025; minimal zincin fold that retains 3-stranded mixed beta-sheet and contains HExxH motif in the C-terminal helix; no metal ion bound to this motif is observed in the first determined structures
  6. 2206170Protein Uncharacterized protein Acel_2062 [160558] (1 species)
  7. 2206171Species Acidothermus cellulolyticus [TaxId:28049] [160559] (1 PDB entry)
    Uniprot A0LWM4 1-113
  8. 2206172Domain d3e11a1: 3e11 A:1-113 [157969]
    Other proteins in same PDB: d3e11a2, d3e11b3
    complexed with act, ca

Details for d3e11a1

PDB Entry: 3e11 (more details), 1.8 Å

PDB Description: crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution
PDB Compounds: (A:) predicted zincin-like metalloprotease

SCOPe Domain Sequences for d3e11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e11a1 d.92.1.17 (A:1-113) Uncharacterized protein Acel_2062 {Acidothermus cellulolyticus [TaxId: 28049]}
mvyvdpdrfdelvaealdgipeefaramrnvavfvedepddpellglyvgiplterttay
ggvlpdriiiyrnticalcetesevidevrktvvheiahhfgidderlhelgy

SCOPe Domain Coordinates for d3e11a1:

Click to download the PDB-style file with coordinates for d3e11a1.
(The format of our PDB-style files is described here.)

Timeline for d3e11a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3e11a2