Lineage for d3e05h_ (3e05 H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502337Species Geobacter metallireducens [TaxId:269799] [188557] (1 PDB entry)
  8. 2502345Domain d3e05h_: 3e05 H: [174429]
    automated match to d1f38a_
    complexed with cl, gol

Details for d3e05h_

PDB Entry: 3e05 (more details), 1.8 Å

PDB Description: crystal structure of precorrin-6y c5,15-methyltransferase from geobacter metallireducens gs-15
PDB Compounds: (H:) Precorrin-6Y C5,15-methyltransferase (Decarboxylating)

SCOPe Domain Sequences for d3e05h_:

Sequence, based on SEQRES records: (download)

>d3e05h_ c.66.1.0 (H:) automated matches {Geobacter metallireducens [TaxId: 269799]}
laqypvigidddefatakklitkqevravtlsklrlqddlvmwdigagsasvsieasnlm
pngrifalernpqylgfirdnlkkfvarnvtlveafapeglddlpdpdrvfiggsggmle
eiidavdrrlksegvivlnavtldtltkavefledhgymvevacvnvaktkglteykmfe
shnpvyiitawks

Sequence, based on observed residues (ATOM records): (download)

>d3e05h_ c.66.1.0 (H:) automated matches {Geobacter metallireducens [TaxId: 269799]}
laqypvigidddefatakklitkqevravtlsklrlqddlvmwdigagsasvsieasnlm
pngrifalernpqylgfirdnlkkfvarnvtlveafapeglddlpdpdrvfiggsggmle
eiidavdrrlksegvivlnavtldtltkavefledhgymvevacvnvaktkgeykmfesh
npvyiitawks

SCOPe Domain Coordinates for d3e05h_:

Click to download the PDB-style file with coordinates for d3e05h_.
(The format of our PDB-style files is described here.)

Timeline for d3e05h_: