Lineage for d3dzha_ (3dzh A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466660Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2466704Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2466705Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2466730Species Human (Homo sapiens) [TaxId:9606] [159490] (45 PDB entries)
    Uniprot P28907 45-291
  8. 2466734Domain d3dzha_: 3dzh A: [174406]
    automated match to d2ef1a1
    complexed with gtp

Details for d3dzha_

PDB Entry: 3dzh (more details), 1.6 Å

PDB Description: crystal structure of human cd38 extracellular domain, gtp complex
PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d3dzha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dzha_ c.23.14.3 (A:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefd
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvknpedssc

SCOPe Domain Coordinates for d3dzha_:

Click to download the PDB-style file with coordinates for d3dzha_.
(The format of our PDB-style files is described here.)

Timeline for d3dzha_: