Lineage for d3dxua_ (3dxu A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425267Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
    Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801
  6. 2425442Protein JMJD2D core [254343] (1 species)
  7. 2425443Species Human (Homo sapiens) [TaxId:9606] [254776] (22 PDB entries)
  8. 2425458Domain d3dxua_: 3dxu A: [245672]
    complexed with fe2, gol, oga, so4, zn

Details for d3dxua_

PDB Entry: 3dxu (more details), 2.2 Å

PDB Description: the crystal structure of core jmjd2d complexed with fe and n- oxalylglycine
PDB Compounds: (A:) JmjC domain-containing histone demethylation protein 3D

SCOPe Domain Sequences for d3dxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxua_ b.82.2.14 (A:) JMJD2D core {Human (Homo sapiens) [TaxId: 9606]}
aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
scgearvtfsmdafvrilqperydlwkrgqd

SCOPe Domain Coordinates for d3dxua_:

Click to download the PDB-style file with coordinates for d3dxua_.
(The format of our PDB-style files is described here.)

Timeline for d3dxua_: