Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d3dxda_: 3dxd A: [174319] automated match to d1wgua_ mutant |
PDB Entry: 3dxd (more details), 2.2 Å
SCOPe Domain Sequences for d3dxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxda_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nelvqkfqvyylgnvpvakpvgvdvingalesvlssssreqwtpshvsvapatltilhqq teavlgecrvrflsflavgrdvhtfafimaagpasfcchmfwcepnaaslseavqaacml ryqkcldarsq
Timeline for d3dxda_: