Lineage for d3dvia_ (3dvi A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1512787Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)
  8. 1512801Domain d3dvia_: 3dvi A: [174282]
    automated match to d1igml_

Details for d3dvia_

PDB Entry: 3dvi (more details), 1.53 Å

PDB Description: Crystal structure of kappa 1 amyloidogenic light chain variable domain
PDB Compounds: (A:) Amyloidogenic light chain variable domain AL-103

SCOPe Domain Sequences for d3dvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dvia_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgvp
srfsgsgsgtdftftisslqpediatyycqqyhnlppytfgpgtkleik

SCOPe Domain Coordinates for d3dvia_:

Click to download the PDB-style file with coordinates for d3dvia_.
(The format of our PDB-style files is described here.)

Timeline for d3dvia_: