Lineage for d3dt2a1 (3dt2 A:2-259)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domainSuperfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) 
Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (25 PDB entries) 
Domain d3dt2a1: 3dt2 A:2-259 [209290]
Other proteins in same PDB: d3dt2a2
automated match to d1khba2
complexed with 1pe, gtp, mn, na, oxl
Details for d3dt2a1
PDB Entry: 3dt2 (more details), 1.5 Å
PDB Description: the structure of rat cytosolic pepck in complex with oxalate and gtp
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]SCOPe Domain Sequences for d3dt2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dt2a1 c.109.1.1 (A:2-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppqlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmq
eegvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseed
fekafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvl
ealgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsll
gkkcfalriasrlakeeg
SCOPe Domain Coordinates for d3dt2a1:
Click to download the PDB-style file with coordinates for d3dt2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dt2a1:
- d3dt2a1 first appeared in SCOPe 2.03
- d3dt2a1 appears in SCOPe 2.05
- d3dt2a1 appears in the current release, SCOPe 2.08
View in 3D
