![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins) |
![]() | Protein RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex [75693] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75694] (9 PDB entries) Uniprot P62877 19-106 |
![]() | Domain d3dplr_: 3dpl R: [157824] automated match to d1ldjb_ complexed with zn |
PDB Entry: 3dpl (more details), 2.6 Å
SCOPe Domain Sequences for d3dplr_:
Sequence, based on SEQRES records: (download)
>d3dplr_ g.44.1.1 (R:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnha fhfhcisrwlktrqvcpldnrewefqkygh
>d3dplr_ g.44.1.1 (R:) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} kkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqasaectvawgvcnhafhf hcisrwlktrqvcpldnrewefqkygh
Timeline for d3dplr_: