Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
Species Escherichia coli [TaxId:562] [49357] (15 PDB entries) |
Domain d3dpaa1: 3dpa A:1-124 [22323] Other proteins in same PDB: d3dpaa2 CA-atoms only |
PDB Entry: 3dpa (more details)
SCOPe Domain Sequences for d3dpaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dpaa1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]} avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrld pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai ktrp
Timeline for d3dpaa1: