Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins) |
Protein Uncharacterized protein Ava2261 [159975] (1 species) |
Species Anabaena variabilis [TaxId:1172] [159976] (1 PDB entry) Uniprot Q3MAV7 1-133 |
Domain d3dmca1: 3dmc A:1-133 [157805] Other proteins in same PDB: d3dmca2, d3dmcb3 complexed with act |
PDB Entry: 3dmc (more details), 1.65 Å
SCOPe Domain Sequences for d3dmca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} mmthysdntlkvahqgfefftqglatgewqkfldmltedftfwfpmgefhglnvgkerak efftyvsesfhtgiqissldrvtsnettvvfefrdeglflgkpyknrvavsfdvrgdkic syreyfgsdgksn
Timeline for d3dmca1: