Lineage for d3dlga2 (3dlg A:430-539)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (16 families) 
consists of one domain of this fold
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) 
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries) 
Domain d3dlga2: 3dlg A:430-539 [199250]
Other proteins in same PDB: d3dlga1, d3dlgb_
automated match to d1c1ba1
complexed with gwe, po4
Details for d3dlga2
PDB Entry: 3dlg (more details), 2.2 Å
PDB Description: Crystal structure of hiv-1 reverse transcriptase in complex with GW564511.
PDB Compounds: (A:) Reverse transcriptase/ribonuclease HSCOPe Domain Sequences for d3dlga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dlga2 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
SCOPe Domain Coordinates for d3dlga2:
Click to download the PDB-style file with coordinates for d3dlga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dlga2:
- d3dlga2 first appeared in SCOPe 2.03
- d3dlga2 appears in SCOPe 2.06
- d3dlga2 appears in the current release, SCOPe 2.08
View in 3D
