Lineage for d3dlda_ (3dld A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234288Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2234289Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2234455Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2234456Protein automated matches [191055] (16 species)
    not a true protein
  7. 2234528Species Xanthomonas oryzae [TaxId:64187] [188927] (13 PDB entries)
  8. 2234530Domain d3dlda_: 3dld A: [174049]
    automated match to d1y6ha_
    complexed with cd

Details for d3dlda_

PDB Entry: 3dld (more details), 2.6 Å

PDB Description: crystal structure of peptide deformylase, xoo1075, from xanthomonas oryzae pv. oryzae kacc10331
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d3dlda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlda_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvlsyd

SCOPe Domain Coordinates for d3dlda_:

Click to download the PDB-style file with coordinates for d3dlda_.
(The format of our PDB-style files is described here.)

Timeline for d3dlda_: