Lineage for d3dida_ (3did A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2769696Protein automated matches [190376] (1 species)
    not a true protein
  7. 2769697Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries)
  8. 2769702Domain d3dida_: 3did A: [157745]
    automated match to d1eta1_
    complexed with act, gol, zn; mutant

Details for d3dida_

PDB Entry: 3did (more details), 1.78 Å

PDB Description: crystal structure of the f87m/l110m mutant of human transthyretin at ph 4.6 soaked
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d3dida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dida_ b.3.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispmhehaevvftandsgprrytiaamlspysysttavvtnp

SCOPe Domain Coordinates for d3dida_:

Click to download the PDB-style file with coordinates for d3dida_.
(The format of our PDB-style files is described here.)

Timeline for d3dida_: