Lineage for d3dhxa1 (3dhx A:2-100)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.18: ACT-like [55021] (15 families) 
regulatory domain linked to a wide range of metabolic enzymes
Family d.58.18.13: NIL domain-like [160322] (2 proteins)
Pfam PF09383
Protein Methionine import ATP-binding protein MetN [160323] (2 species) 
Species Escherichia coli [TaxId:562] [160325] (2 PDB entries)
Uniprot P30750 241-343! Uniprot P30750 247-343
Domain d3dhxa1: 3dhx A:2-100 [157739]
complexed with iod
Details for d3dhxa1
PDB Entry: 3dhx (more details), 2.1 Å
PDB Description: Crystal structure of isolated C2 domain of the methionine uptake transporter
PDB Compounds: (A:) Methionine import ATP-binding protein metNSCOPe Domain Sequences for d3dhxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dhxa1 d.58.18.13 (A:2-100) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}
ldipedyqerlqaepftdcvpmlrleftgqsvdapllsetarrfnvnnniisaqmdyagg
vkfgimltemhgtqqdtqaaiawlqehhvkvevlgyvle
SCOPe Domain Coordinates for d3dhxa1:
Click to download the PDB-style file with coordinates for d3dhxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dhxa1:
- d3dhxa1 first appeared in SCOP 1.75
- d3dhxa1 appears in SCOPe 2.04
- d3dhxa1 appears in SCOPe 2.06
- d3dhxa1 appears in the current release, SCOPe 2.08
View in 3D
