Lineage for d3dhpa1 (3dhp A:409-496)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811079Species Human (Homo sapiens) [TaxId:9606] [225771] (22 PDB entries)
  8. 2811083Domain d3dhpa1: 3dhp A:409-496 [157725]
    Other proteins in same PDB: d3dhpa2
    automated match to d1jxka1
    complexed with ca, cl, glc, hmc

Details for d3dhpa1

PDB Entry: 3dhp (more details), 1.5 Å

PDB Description: probing the role of aromatic residues at the secondary saccharide binding sites of human salivary alpha-amylase in substrate hydrolysis and bacterial binding
PDB Compounds: (A:) Alpha-amylase 1

SCOPe Domain Sequences for d3dhpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dhpa1 b.71.1.0 (A:409-496) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d3dhpa1:

Click to download the PDB-style file with coordinates for d3dhpa1.
(The format of our PDB-style files is described here.)

Timeline for d3dhpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dhpa2