Lineage for d3ddlb_ (3ddl B:)
- Root: SCOPe 2.08
Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membraneSuperfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) 
Pfam PF13853. Phylogeny described in PubMed 12761335
Family f.13.1.0: automated matches [227143] (1 protein)
not a true familyProtein automated matches [226845] (25 species)
not a true protein
Species Salinibacter ruber [TaxId:146919] [255796] (1 PDB entry) 
Domain d3ddlb_: 3ddl B: [245625]
automated match to d4hyjb_
complexed with pcw, px4, ret, sxn, unl
Details for d3ddlb_
PDB Entry: 3ddl (more details), 1.9 Å
PDB Description: crystallographic structure of xanthorhodopsin, a light-driven ion pump with dual chromophore
PDB Compounds: (B:) XanthorhodopsinSCOPe Domain Sequences for d3ddlb_:
Sequence, based on SEQRES records: (download)
>d3ddlb_ f.13.1.0 (B:) automated matches {Salinibacter ruber [TaxId: 146919]}
lptltpgqyslvfnmfsftvatmtasfvffvlarnnvapkyrismmvsalvvfiagyhyf
ritssweaayalqngmyqptgelfndayryvdwlltvplltvelvlvmglpknergplaa
klgflaalmivlgypgevsenaalfgtrglwgflstipfvwilyilftqlgdtiqrqssr
vstllgnarllllatwgfypiaymipmafpeafpsntpgtivalqvgytiadvlakagyg
vliyniakakseeegfn
Sequence, based on observed residues (ATOM records): (download)
>d3ddlb_ f.13.1.0 (B:) automated matches {Salinibacter ruber [TaxId: 146919]}
lptltpgqyslvfnmfsftvatmtasfvffvlarnnvapkyrismmvsalvvfiagyhyf
ritssweaayalqngmyqptgelfndayryvdwlltvplltvelvlvmglpknergplaa
klgflaalmivlgypgevsenaalfgtrglwgflstipfvwilyilftqlgdtiqrqssr
vstllgnarllllatwgfypiaymipmantpgtivalqvgytiadvlakagygvliynia
kakseeegfn
SCOPe Domain Coordinates for d3ddlb_:
Click to download the PDB-style file with coordinates for d3ddlb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ddlb_:
- d3ddlb_ first appeared in SCOPe 2.04
- d3ddlb_ appears in SCOPe 2.07
View in 3D
