Lineage for d3dc5a2 (3dc5 A:86-194)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946456Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225669] (8 PDB entries)
  8. 2946459Domain d3dc5a2: 3dc5 A:86-194 [209081]
    Other proteins in same PDB: d3dc5a1, d3dc5c1, d3dc5c3
    automated match to d1bsma2
    complexed with mli, mn

Details for d3dc5a2

PDB Entry: 3dc5 (more details), 1.7 Å

PDB Description: Crystal Structure of a manganese superoxide dismutases from Caenorhabditis elegans
PDB Compounds: (A:) Superoxide dismutase [Mn] 2

SCOPe Domain Sequences for d3dc5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dc5a2 d.44.1.0 (A:86-194) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gepskelmdtikrdfgsldnlqkrlsditiavqgsgwgwlgyckkdkilkiatcanqdpl
egmvplfgidvwehayylqyknvrpdyvhaiwkianwkniserfanarq

SCOPe Domain Coordinates for d3dc5a2:

Click to download the PDB-style file with coordinates for d3dc5a2.
(The format of our PDB-style files is described here.)

Timeline for d3dc5a2:

2946459
d3dc5a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3dc5a1