| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family) ![]() Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats |
| Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins) |
| Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species) |
| Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry) Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124 |
| Domain d3dbya2: 3dby A:126-260 [157487] complexed with edo, fe |
PDB Entry: 3dby (more details), 2.1 Å
SCOP Domain Sequences for d3dbya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbya2 a.29.13.1 (A:126-260) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
vfhelhyhlvwltdaaghagsisggldlvekrlkekseeftkhfeqfylkavemtgylrt
elhhfpalkkftkdvslelklfshflheveelelsnevlsvlsarmadhmareecyyllk
laqssglempkcnpl
Timeline for d3dbya2:
View in 3DDomains from other chains: (mouse over for more information) d3dbyb1, d3dbyb2, d3dbyc1, d3dbyc2, d3dbyd1, d3dbyd2, d3dbye1, d3dbye2, d3dbyf1, d3dbyf2, d3dbyg1, d3dbyg2, d3dbyh1, d3dbyh2, d3dbyi1, d3dbyi2, d3dbyj1, d3dbyj2, d3dbyk1, d3dbyk2, d3dbyl1, d3dbyl2, d3dbym1, d3dbym2, d3dbyn1, d3dbyn2, d3dbyo1, d3dbyo2, d3dbyp1, d3dbyp2, d3dbyq1, d3dbyq2, d3dbyr1, d3dbyr2, d3dbys1, d3dbys2, d3dbyt1, d3dbyt2 |