Lineage for d3dbya2 (3dby A:126-260)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767717Superfamily a.29.13: Bacillus cereus metalloprotein-like [158430] (1 family) (S)
    Duplication: tandem repeat of two domains of this fold with similar sequences; binds a dimetal ion cluster between the repeats
  5. 767718Family a.29.13.1: Bacillus cereus metalloprotein-like [158431] (2 proteins)
  6. 767719Protein Uncharacterized protein BCE_G9241_0798 [158434] (1 species)
  7. 767720Species Bacillus cereus [TaxId:1396] [158435] (1 PDB entry)
    Uniprot Q4MWP8 125-259! Uniprot Q4MWP8 4-124
  8. 767722Domain d3dbya2: 3dby A:126-260 [157487]
    complexed with edo, fe

Details for d3dbya2

PDB Entry: 3dby (more details), 2.1 Å

PDB Description: crystal structure of uncharacterized protein from bacillus cereus g9241 (csap target)
PDB Compounds: (A:) Uncharacterized protein

SCOP Domain Sequences for d3dbya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbya2 a.29.13.1 (A:126-260) Uncharacterized protein BCE_G9241_0798 {Bacillus cereus [TaxId: 1396]}
vfhelhyhlvwltdaaghagsisggldlvekrlkekseeftkhfeqfylkavemtgylrt
elhhfpalkkftkdvslelklfshflheveelelsnevlsvlsarmadhmareecyyllk
laqssglempkcnpl

SCOP Domain Coordinates for d3dbya2:

Click to download the PDB-style file with coordinates for d3dbya2.
(The format of our PDB-style files is described here.)

Timeline for d3dbya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dbya1