Lineage for d3dara1 (3dar A:153-249)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (10 PDB entries) 
Domain d3dara1: 3dar A:153-249 [157466]
automatically matched to d1djsa1
Details for d3dara1
PDB Entry: 3dar (more details), 2.2 Å
PDB Description: Crystal structure of D2 domain from human FGFR2
PDB Compounds: (A:) Fibroblast growth factor receptor 2SCOPe Domain Sequences for d3dara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]}
apywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnq
hwslimesvvpsdkgnytcvveneygsinhtyhldvv
SCOPe Domain Coordinates for d3dara1:
Click to download the PDB-style file with coordinates for d3dara1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3dara1:
- d3dara1 first appeared in SCOP 1.75
- d3dara1 appears in SCOPe 2.02
- d3dara1 is called d3dara_ in SCOPe 2.04
- d3dara1 appears in the current release, SCOPe 2.08, called d3dara_
View in 3D
